FOXO4 DRI

FOXO4 DRI

FOXO4 DRI is a synthetic peptide that has been studied for its potential use in preventing age-related diseases, extending lifespan, and increasing overall health and wellness.

Description

Product Name: FOXO4-DRI

Forkhead box protein O4, Proxofim, FOXO4a, AFX, AFX1, MLLT7
Sequence: H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH
Three letter code: H-D-Leu-D-Thr-D-Leu-D-Arg-D-Lys-D-Glu-D-Pro-D-Ala-D-Ser-D-Glu-D-Ile-D-Ala-D-Gln-D-Ser-D-Ile-D-Leu-D-Glu-D-Ala-D-Tyr-D-Ser-D-Gln-D-Asn-D-Gly-D-Trp-D-Ala-D-Asn-D-Arg-D-Arg-D-Ser-D-Gly-D-Gly-D-Lys-D-Arg-D-Pro-D-Pro-D-Pro-D-Arg-D-Arg-D-Arg-D-Gln-D-Arg-D-Arg-D-Lys-D-Lys-D-Arg-D-Gly-OH
Purity: >98.0%
Appearance: White Lyophilized Powder
Specification:10mg or according to custom
Storage: After reconstitution store at 2°C - 8°C

FOXO4 DRI Manufacturer

What is FOXO4-DRI ?
FOXO4 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging' by Baar et al. FOXO4 DRIpeptide comprising the amino acid sequence: LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues. FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to Chemotoxicity and Aging.
Only for Reseach&Lab use.

Hot Tags: foxo4 dri, foxo4 dri manufacturers, suppliers, factory, Biotinyl Ghk Hair Growth, Vasoactive Intestinal Peptides, Ghk Copper, Myristoyl Pentapeptide 17 For Hair Growth, High Molecular Weight Hyaluronic Acid Powder, Epithalon Peptide

You Might Also Like

Shopping Bags