Cecropin A
video
Cecropin A

Cecropin A

Cecropin A is a linear 37-residue antimicrobial polypeptide, with anticancer and anti-inflammatory activity.

Description

Product name: Cecropin A
CAS No. 80451-04-3
Molecular Weight 4003.78
Molecular Formula :C184H313N53O46
Sequence: Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2

80451-04-3 supplier
Sequence Shortening : KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
Purity :Peak Area by HPLC ≥95%
Appearance: White powder
Target: Antibacterial

peptide price

Descriptions:
Cecropin A, as one of the earliest antimicrobial peptides to be isolated and identified, has received extensive research attention for its broad-spectrum antimicrobial activity and unique structural properties since it was first discovered from the larvae of C. stilpinis.

Structural characteristics of Cecropin A.
Cecropin A consists of 34 amino acids in a linear structure and contains multiple hydrophobic and charged amino acid residues, which confers it with the ability to form pores on the cell membrane. The N-terminus of Cecropin A is mainly composed of hydrophobic amino acids, while the C-terminus is rich in positively charged amino acids, and this zwitterionic distribution pattern helps the peptide interact with the anionic phospholipid head, which in turn penetrates the microbial cell membrane, causing the cell contents to leak and ultimately lead to cell death.

Note: The product is for laboratory research use.
 

Hot Tags: cecropin a, cecropin a manufacturers, suppliers, factory, Palmitoyl Tripeptide 5, Sericin Powder, Acetyl Tetrapeptide 3 Hair Growth, Oligopeptide 1 For Skin, Hydroxypropyl Tetrahydropyrantriol In Skin Care, Anti Aging Ingredients

You Might Also Like

Shopping Bags